2.50 Rating by ClearWebStats
greatcanadianrivers.com is 2 decades 4 years 3 months old. This website has a #8,044,752 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 5 out of 10. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. It is also listed in Dmoz. While no active threats were reported recently by users, greatcanadianrivers.com is SAFE to browse.
Get Custom Widget

Traffic Report of Greatcanadianrivers

Daily Unique Visitors: 60
Daily Pageviews: 120

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: 15

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 14
Alexa BackLinks: 87

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for greatcanadianrivers.com Good
WOT Privacy: WOT privacy rank for greatcanadianrivers.com Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View greatcanadianrivers.com Pagerank
Alexa Rank: 8,044,752
Domain Authority: Not Applicable
Google Pagerank
PR 5 out of 10
PageSpeed Score
60
Siteadvisor Rating
View greatcanadianrivers.com site advisor rating Not Applicable

Where is greatcanadianrivers.com server located?

Hosted IP Address:

207.253.66.226 View other site hosted with greatcanadianrivers.com

Hosted Country:

greatcanadianrivers.com hosted country CA greatcanadianrivers.com hosted country

Location Latitude:

45.5009

Location Longitude:

-73.5606

Social Engagement

Facebook Shares: 7
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View greatcanadianrivers.com HTML resources

Homepage Links Analysis

Great Canadian Rivers and Salmon Undercurrents
Take a multimedia tour of Canadian rivers. Explore the history, ecosystems, culture, recreation and industry of Canada's greatest waterways. Facts, figures and descriptions include natural environment, fish and wildlife, salmon species, outdoor travel, eco-tourism, parks, trails, sport fishing, whitewater canoeing, kayaking, cycling, hiking, birdwatching, First Nations cultures, historical figures and events, heritage and historic sites, museums, festivals, cultural attractions, economy and much more

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 14
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 207.253.66.226)

Le Journal de Montréal

greatcanadianrivers.com favicon - jdem.com

View greatcanadianrivers.com Pagerank   greatcanadianrivers.com alexa rank 10,822,907   greatcanadianrivers.com website value $ 8.95

Le Journal de Montréal

greatcanadianrivers.com favicon - lejournaldemontreal.com

View greatcanadianrivers.com Pagerank   greatcanadianrivers.com alexa rank 1,063,154   greatcanadianrivers.com website value $ 720.00

Canada's Home for Hard News and Straight Talk

greatcanadianrivers.com favicon - sunnewsnetwork.ca

SunNewsNetwork.ca uses video, photos, and interactive tools to cover Canada's national and international news, politics, and varying opinions.

View greatcanadianrivers.com Pagerank   greatcanadianrivers.com alexa rank 33,841   greatcanadianrivers.com website value $ 245,520.00

Jobboom

greatcanadianrivers.com favicon - jobboom.ca

View greatcanadianrivers.com Pagerank   greatcanadianrivers.com alexa rank 26,480,253   greatcanadianrivers.com website value $ 8.95

Bienvenue sur Groupe TVA | Groupe TVA

greatcanadianrivers.com favicon - groupetva.ca

View greatcanadianrivers.com Pagerank   greatcanadianrivers.com alexa rank 1,050,935   greatcanadianrivers.com website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache/1.3.26 (Unix)
Last-Modified: Tue, 04 Dec 2012 15:14:44 GMT
ETag: "e5406a-6c87-50be1364"
Content-Type: text/html
Content-Length: 27783
Date: Sun, 01 Jun 2014 10:33:07 GMT
X-Varnish: 899139014
Age: 0
Via: 1.1 varnish
Connection: close
X-Cache: MISS

Domain Information for greatcanadianrivers.com

Domain Registrar: WEBNAMES.CA INC. greatcanadianrivers.com registrar info
Registration Date: 2000-01-12 2 decades 4 years 3 months ago
Last Modified: 2013-12-13 1 decade 4 months 1 week ago
Expiration Date: 2015-01-12 9 years 3 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.canoe.ca greatcanadianrivers.com name server information 205.151.222.253 greatcanadianrivers.com server is located in Canada Canada
ns2.canoe.ca greatcanadianrivers.com name server information 205.151.222.254 greatcanadianrivers.com server is located in Canada Canada

DNS Record Analysis

Host Type TTL Extra
greatcanadianrivers.com A 893 IP:207.253.66.226
greatcanadianrivers.com NS 900 Target:dns1.videotron.net
greatcanadianrivers.com NS 900 Target:dns2.videotron.net
greatcanadianrivers.com SOA 900 MNAME:ns-master.canoe.ca
RNAME:dnsmaster.canoe.ca
Serial:2010021101
Refresh:10800
Retry:900
Expire:2592000

Similarly Ranked Websites to Greatcanadianrivers

xxx

greatcanadianrivers.com favicon - smmpaneliturkiye.com

View greatcanadianrivers.com Pagerank   Alexa rank for greatcanadianrivers.com 8,044,757   website value of greatcanadianrivers.com $ 8.95

Anything and Everything Wisconsin, your complete Wisconsin vacation guide

greatcanadianrivers.com favicon - anythingwisconsin.com

Anything and Everything Wisconsin, resorts, campgrounds, hotels, fishing and hunting guides, beer, cheese, the best of Wisconsin and all it has to offer.

View greatcanadianrivers.com Pagerank   Alexa rank for greatcanadianrivers.com 8,044,765   website value of greatcanadianrivers.com $ 8.95

403 Forbidden

greatcanadianrivers.com favicon - barkatagro.com

View greatcanadianrivers.com Pagerank   Alexa rank for greatcanadianrivers.com 8,044,769   website value of greatcanadianrivers.com $ 8.95

Account Suspended

greatcanadianrivers.com favicon - resellerflipkartdailydhamaka.info

View greatcanadianrivers.com Pagerank   Alexa rank for greatcanadianrivers.com 8,044,772   website value of greatcanadianrivers.com $ 8.95

Порно засунул голову в пизду - www.dproxi.ru

greatcanadianrivers.com favicon - dproxi.ru

Бесплатное на этом секс порно портале online 720p

View greatcanadianrivers.com Pagerank   Alexa rank for greatcanadianrivers.com 8,044,774   website value of greatcanadianrivers.com $ 8.95